Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Dear Candidate, Greetings of the day! We are Hiring forApplication Lead- Murex Datamart Reporting Duties and Responsibilities Role: Application Lead Role Description: Lead the effort to design,bu...
scripting application murex sql unix datamart unixscripting reporting java eadAbsolute owner of the numbers for the territory (accountable). Execute the Territory business plan(including forcasting, and sales volume achievement). Focus on medium to big feeders (15 to 50 milk co...
salesmarketing business developmenttarget retailarea sales data collectionterritory sales1. Participate in preventive maintenance program for plant equipment, machinery and related facilities; identify equipment maintenance needs; record mechanical equipment readings; ensure accuracy of r...
equipment maintenanceproject engineering management plant safetymechanical troubleshootingpreventive maintenance maintenance acti1. Participate in preventive maintenance program for plant equipment, machinery and related facilities; identify equipment maintenance needs; record mechanical equipment readings; ensure accuracy of r...
equipment maintenanceproject engineering management plant safetymechanical troubleshootingpreventive maintenance maintenance acti1. Participate in preventive maintenance program for plant equipment, machinery and related facilities; identify equipment maintenance needs; record mechanical equipment readings; ensure accuracy of r...
equipment maintenanceproject engineering management plant safetymechanical troubleshootingpreventive maintenance maintenance acti1. Participate in preventive maintenance program for plant equipment, machinery and related facilities; identify equipment maintenance needs; record mechanical equipment readings; ensure accuracy of r...
equipment maintenanceproject engineering management plant safetymechanical troubleshootingpreventive maintenance maintenance actiPosition Murex Business Analyst Relevant experience 2 - 7 years of IT experience Qualification B.Tech, Comp Science, MCA Skills C, C++, Java, JSP, XML, dot net, ASP. Net, SQL, PL/ SQL Domain Financial...
documentation businessrequirements capitalmarkets businessanalysis financialservices databasemigration architecturaldesign sql xml net ustomerrelations requirements functional quantitativemanagement itJOB Code: JD-09-0907B Designation: Executive - Transmission Company: Client of AJ CONSULTANTS Industry: Power Location: Ahmedabad Experience: 3 - 5 Yrs Education: BE Electrical JOB DESCRIPTION: Minimu...
powertransmission bar transmission azardousareas powertransf mers transmissionlines bus 400kv imp feeders business equipment unloading substation monit ing protection transf mer transf mers IntrinsicSafetyMaintenance Engineer : Diploma in Mechanical Engineering. Around 10 years of experience in chemical/ fertilizer industry or any continuous process plant. Experienced in maintenance of crusher, pumps...
mechanical preventivemaintenance safety troubleshooting plc continuousprocess pumps blowers grinding maintenance FlowChemistry ProcessAnalyticalTechnology VacuumDistillation Crystallization onveycompress BatchMurex BAU & Technical Support for a large European Bank Responsibilities Murex related Responsibilty: 1) Handling Murex production batch processing includes Date rolls for Various desks and entities...
sql unix sqlserver sla unixshellscripting tradelifecycle creditrisk marketrisk marketdata shellscripting processcontrol roductionsupp interestratederivatives lifecycle backoffice filesystemDear Candidate, We are looking for Project Engineer For Faridabad Location , who do have hands on Knowledge of Pipe line & Fittings, Knowledge of Autocad / Ironcad, Knowledge of MS Office & Open Offi...
bom customerrelations processengineering safety projectplanning mechanicalengineering design projectengineeringmanagement siteengineering projectcoordination projectestimation commissioning inspection costestimation pipingdesign rojectenginExperience - Min 5 to 8 years Education- B.E Mineral processing/Mechanical/Mining Area of responsibility: Knowledge in Design & sizing of Comminution/crushers- Jaw crushers/Cone crushers/Gyratory crus...
estimationtender salesprocurement automationmachine design material handlingbasic codesJOB Code: JD-09-0907B Designation: Executive - Transmission Company: Client of AJ CONSULTANTS Industry: Power Location: Ahmedabad Experience: 3 - 5 Yrs Education: BE Electrical JOB DESCRIPTION: Minimu...
powertransmission bar transmission azardousareas powertransf mers transmissionlines bus 400kv imp feeders business equipment unloading substation monit ing protection transf mer transf mers IntrinsicSafety The company drives all Murex change work at Tier-1 Australia Bank.
Currently, will look to take on all Murex functional, technical and environments management support as well as new features impl...
Should be a I.T.I. - Fitter / Electrical with 2 to 3 years of experience in same field. To supervise the erection & commissioning the Dust Collection System, Centrifugal Blower, Pneumatic Conveying S...
testing pneumatics inspection dust feeders erection scrubbers commissioning supervision safety troubleshooting mechanical centrifugal echanicalassembly oilpainting pneumaticconveying dustcollectionWe are Hiring Deck, Engine Cadet and Ratings for Itf and Rpsl Comanies, Experienced Candidates are Preferred and Freshers are also Welcome, We are in Crewing Business Since 2011 and have Placed More T...
We are Hiring Deck, Engine Cadet and Ratings for Itf and Rpsl Comanies, Experienced Candidates are Preferred and Freshers are also Welcome, We are in Crewing Business Since 2011 and have Placed More T...
Sr. ENGINEER PROPOSALS Bulk Material handling B.E / Diplomo (Mech) 4 8 Years experience in Bulk Material handling 16 - 06 - 2015,...
bulkmaterialhandling materialhandling proposals Hoppers PneumaticConveying Feeders Silos DustCollection PowderHandling BulkSales Sidewinder MaterialHandlingEquipment PalletRacking onveyMezzanineFloA vibrating hospital at Kolkata immediately wants : A. Consultant -MD or DNB Medicine Exp:4 to 5 years SAL: 1.8 -2 lac (indicative) Duty Timings: 6 days a week (9.30 am to 6.3...
consulting dnb medicine nterventional internalmedicine radiodiagnosisA vibrating hospital at Kolkata immediately wants : 1.DM Cardiology Exp:7 to 9 years -Should have exposure in radial plasty as well as radial angioplasty, and worked in high volume centre, S...
neurology gastroenterology dnb adialangioplasty acutecare dm nephrology hospital criticalcare endoscopy emergency radialplasty colonoscopy intensivecare ercp angioplasty healthcaremanagement interventionalcardiologyDesign, build and configure applications to meet business process and application requirements. Must Have Skills :Murex Workflows Good To Have Skills :Murex Back Office A Design, ...
MxML urexL3supp kflowsD goodcommunication goodanalyticalMurex BAU & Technical Support for a large European Bank Responsibilities Murex related Responsibilty: 1) Handling Murex production batch processing includes Date rolls for Various desks and entities...
sqlunixsqlserverslaunixshellscriptingtradelifecyclecreditriskmarketriskmarketdatashellscriptingprocesscontrolroductionsuppinterestratederivativeslifecyclebackofficefilesystemA vibrating hospital at Kolkata immediately wants : A. Consultant -MD or DNB Medicine Exp:4 to 5 years SAL: 1.8 -2 lac (indicative) Duty Timings: 6 days a week (9.30 am to 6.3...
consultingdnbmedicinenterventionalinternalmedicineradiodiagnosisA vibrating hospital at Kolkata immediately wants : 1.DM Cardiology Exp:7 to 9 years -Should have exposure in radial plasty as well as radial angioplasty, and worked in high volume centre, S...
neurologygastroenterologydnbadialangioplastyacutecarenephrologyhospitalcriticalcareendoscopyemergencyradialplastycolonoscopyintensivecareercpangioplastyhealthcaremanagementinterventionalcardiologyWe are looking for Lead Developers with background in Murex DataMart, PLSQL, Unix and Java with experience in building high-performing, scalable, enterprise-grade applications. You will be part of a t...
programmingtuningdatamartenvironmentunixsoftwarephpextractionautocadperljavaWe are looking for Lead Developers with background in Murex DataMart, PLSQL, Unix and Java with experience in building high-performing, scalable, enterprise-grade applications. You will be part of a t...
programmingtuningdatamartenvironmentunixsoftwarephpextractionautocadperljavaWe are looking for Lead Developers with background in Murex DataMart, PLSQL, Unix and Java with experience in building high-performing, scalable, enterprise-grade applications. You will be part of a t...
programmingtuningdatamartenvironmentunixsoftwarephpextractionautocadperljavaWe are looking for Lead Developers with background in Murex DataMart, PLSQL, Unix and Java with experience in building high-performing, scalable, enterprise-grade applications. You will be part of a t...
programmingtuningdatamartenvironmentunixsoftwarephpextractionautocadperljavaWe are looking for Lead Developers with background in Murex DataMart, PLSQL, Unix and Java with experience in building high-performing, scalable, enterprise-grade applications. You will be part of a t...
programmingtuningdatamartenvironmentunixsoftwarephpextractionautocadperljavaWe are looking for Lead Developers with background in Murex DataMart, PLSQL, Unix and Java with experience in building high-performing, scalable, enterprise-grade applications. You will be part of a t...
programmingtuningdatamartenvironmentunixsoftwarephpextractionautocadperljavaWe are looking for Lead Developers with background in Murex DataMart, PLSQL, Unix and Java with experience in building high-performing, scalable, enterprise-grade applications. You will be part of a t...
programmingtuningdatamartenvironmentunixsoftwarephpextractionautocadperljavaShould be a I.T.I. - Fitter / Electrical with 2 to 3 years of experience in same field. To supervise the erection & commissioning the Dust Collection System, Centrifugal Blower, Pneumatic Conveying S...
testingpneumaticsinspectiondustfeederserectionscrubberscommissioningsupervisionsafetytroubleshootingmechanicalcentrifugalechanicalassemblyoilpaintingpneumaticconveyingdustcollection
JOB Code: JD-09-0907B Designation: Executive - Transmission Company: Client of AJ CONSULTANTS Industry: Power Location: Ahmedabad Experience: 3 - 5 Yrs Education: BE Electrical JOB DESCRIPTION: Minimu...
powertransmissionbartransmissionazardousareaspowertransfmerstransmissionlinesbus400kvimpfeedersbusinessequipmentunloadingsubstationmonitingprotectiontransfmertransfmersIntrinsicSafetyAnalyze business requirement then design and developed datamart objects To deliver Report Catalogue Reporting architecture design solution for a Murex reporting Analyze and optimize the feeders A...
documentationbusinessrequirementsbusinessanalysisdatabasemigrationarchitecturaldesignsqlxmljspnetmurexdesignscienceustomerrelationsrequirementsfunctionalcompbinaryaspnetfeedersbusinessSkills C, C , Java, JSP, XML, dot net, ASP. Net, SQL,PL/SQL Domain Financial Services Capital markets, Derivatives Roles and Responsibility Analyze business requirement then design and developed data...
documentationbusinessrequirementscapitalmarketsfinancialservicesdatabasemigrationarchitecturaldesignsqlxmlnetaspjspjavaustomerrelationsrequirementsfunctionalaspnetquantitativemanagementdotSkills C, C , Java, JSP, XML, dot net, ASP. Net, SQL, PL/ SQL Domain Financial Services Capital markets, Derivatives Roles and Responsibility Analyze business requirement then design and developed da...
documentationbusinessrequirementscapitalmarketsfinancialservicesdatabasemigrationarchitecturaldesignsqlxmlnetaspjspjavaustomerrelationsrequirementsfunctionalaspnetquantitativemanagementdotPosition Murex Business Analyst Relevant experience 2 - 7 years of IT experience Qualification B.Tech, Comp Science, MCA Skills C, C++, Java, JSP, XML, dot net, ASP. Net, SQL, PL/ SQL Domain Financial...
documentationbusinessrequirementscapitalmarketsbusinessanalysisfinancialservicesdatabasemigrationarchitecturaldesignsqlxmlnetustomerrelationsrequirementsfunctionalquantitativemanagementA vibrating hospital at Kolkata immediately wants : 1.DM Cardiology Exp:7 to 9 years -Should have exposure in radial plasty as well as radial angioplasty, and worked in high volume centre, S...
neurologygastroenterologydnbadialangioplastyacutecarenephrologyhospitalcriticalcareendoscopyemergencyradialplastycolonoscopyintensivecareercpangioplastyhealthcaremanagementinterventionalcardiologyA vibrating hospital at Kolkata immediately wants : A. Consultant -MD or DNB Medicine Exp:4 to 5 years SAL: 1.8 -2 lac (indicative) Duty Timings: 6 days a week (9.30 am to 6.3...
consultingdnbmedicinenterventionalinternalmedicineradiodiagnosis
JOB DESCRIPTION Electrical Engineer Consultant Experienced for more than 10 years in FEED and Detailed Design of Electrical Engineering projects. Will be responsible for LV Electrical detailed desig...
designengineeringlectricalIn this role, you have the opportunity to Monitor and coordinate the different sub-system feeders to this process such as complaint handling, engineering change orders, kit suppliers, regulatory submi...
htmlrisk- Position is for Process Engineering Assembly Division - APQP and PPAP documents as per AITF - Make Machine Specification RFQ sheets and Arrange Quotations - Productivity Improvements in exiting l...
cadrfqspmspcecndcnppapapqpjigssaleshindidesignfood- Position is for Process Engineering Assembly Division - Productivity Improvements in exiting line - Improvement for Customer Complaints and DCN/ECN - Poka Yoke - Customer complaint analysis - Gen...
cadrfqspmspcecndcnppapapqpjigssaleshindidesignfood© 2019 Hireejobs All Rights Reserved