Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Business head 1 10 years and above 12 lakh and above View Job profile: a.Managing and implementation of a strategic business program designed to build and reinforce the organizations role and reputati...
salesmarketingbusiness developmentmanagementcustomer relationsquality assurancestrategic businesssteeldesignbusinessstrategyassurancemetallurgyevaluationreputationteam perfmancereptingnetwkingcollecDo you have Expertise in Java and Java Enterprise technology applications architecture , design , development and support 2 - 5 years experience in designing and developing scalable enterprise lev...
javamysqljsphibernatespringweb servicesdata cachingit managementdatabase designweb applicationsquality assuranceapplication designaccess technologiesdistributed applicationsperfmance improvement2. Business Development Manager/ Area Manager Ambitious, livewire individuals looking for a fast paced, performance oriented growth in Pharmaceutical marketing. Requirement: The individuals should ha...
salesmarketingbusiness developmentcustomer relationstargetmarket shareteam handlingteam buildingteam motivationofferstrainingbusinessadditionlivewiredesignationcompensationimplementationperfmanceDatabase Lead/ Database Architecture We have an urgent opening for the opening of Database Lead/ Database Architecture for a Leading Company for Bangalore (Karnataka)) location. Job Title Database Lea...
sql serverdatabase administrationdatabase designsqlaudio masteringdatabase architectureretailsalarydatabasewarehousearchitecturecommunicationacleacle database administrationacle databaseperfmanceBusiness Development Manager (Male/ Female) ( Profile Code 106) (9 Post) Qualification : Graduates / Post graduates Experience : 1 year 3 years of relevant experience Salary : Best in the Industry. ...
convincing powerbusiness developmentsetmailsalesvisitsalarybusinessresellerscommunicationInternational SalesStrategic PartnershipsSales ProcesssalesfperfmanceBusinesstoBusinessChannel PartneAccount Executive- SMM Account Executive - SMM for Mumbai - Pune Responsibilities Responsible for the execution of the social media campaign for our clients. Ideation on better strategies to grow ...
social mediasmmFacebookBloggingPress ReleasesSocial Media MarketingMedia RelationsTwitterPublicityCopywritingNewslettersConsultant LiaisonInternational LiaisonTechnical Liaisonate liaisonperfmanceProvide support and documentation Educational RequirementsBE / B.Tech(CSE , IT)ME / M.Tech(CSE , IT) , MSc(CS , IT) , MCA with First Class Credentials Work Experience : 3 to 6 Years (minimum exp is...
data analysisautomation toolsmanagement skillsseleniumsoftwareanalysiseducationownershipmanagementautomationsupervisioncredentialsStatistical ModelingStatisticsLogistic RegressionperfmancePredictive ModeliJob Role : Senior Developer / Lead / Architect Job ResponsibilityHave implemented at least two mobile applications on iOS and Android , preferably for customer support application. He / She will be d...
mobile applicationsiosdesignmobileandroideducationengineeringarchitectureMobile ContentMobile InternetMobile StrategyWirelessSymbianS60customer suppperfmanceBinary Runtime Environment fiPhone ApplSeek customer feedback and develop action plans for improvement. Proactively communicate with customers and manage their expectations. Troubleshoot problems and resolve issues to maintain/ improve...
problem solvingcustomer satisfactionbpocourtesyanalyticalresolutionsdocumentationProblem AnalysisPlanningProblem SensitivitySocial Perceptivenesscustomer suppperfmanceOperation MonitingDecisionMakingLocation: Indore Qualification: Graduate/PG Experience: 6 12 Months Total Vacancy: 05 Desired Candidate Profile: Command over English speaking and decent Hindi. Excellent at Client handling and s...
agilecustomer relationsdocumentationdeliveryrequirementsclient handlingsalesenglishmannerscommandSoftware IndustryDemand GenerationMarketing AutomationComplex SalesBusiness AlliancesperfmanceLead GenerDesired Candidate Profile: Command over English speaking and decent Hindi. Excellent at Client handling and servicing. Telephone Manners Etiquettes. Knowledge of Financial Market is an added advant...
customer relationsdocumentationrequirementsfunctionalbusiness requirementsclient handlingsalesenglishmannerscommandSoftware IndustryDemand GenerationMarketing AutomationComplex SalesperfmanceBusiness AllDesired Candidate Profile: Command over English speaking and decent Hindi. Excellent at Client handling and servicing. Telephone Manners Etiquettes. Knowledge of Financial Market is an added advant...
agilecustomer relationsdocumentationdeliveryrequirementsclient handlingsalesenglishmannerscommandSoftware IndustryDemand GenerationMarketing AutomationComplex SalesBusiness AlliancesperfmanceLead GenerExperience1.10 yrs to 10.4yrs Salary Not a Constraint for right candidate Job Summary Dear Candidate We have an urgent opening in Noida for Performance Testing for one of our reputed client Profile 1...
jmeterdatabasestestingwebtesting toolsprofilerintegrationapismiddlewareperfmance testing1.10yrs or more years experience with performance testing tools and performance testing project execution. 1. Hands On Experience with any Industry Standard Load Testing Solutions like Jmeter, Blazeme...
jmeterdatabasestestingwebtesting toolsprofilerintegrationapismiddlewareperfmance testingAndroid DevelopersCurrent Vacancies : 2Education: BCA/ B.Tech (CS/ IT)/ B.E (CS/ IT)/ M.Tech/ MCAExperience: 1 to 2 years Skills Required:Strong knowledge of Android SDK, different versions of Androi...
androidjavajsonapicomandroid sdkoptimization strategiessdkdesignthreadingecosystemvacanciesbenchmarkingNDKDDMSAndroid StudioADBageperfmanceManage Customer s products and services coming from all the web properties of Customer, analyse demographics, website trends, performance metrics and competitive trends to drive web traffic towards th...
htmlseocsscmsautomationweb trafficmetricsenquiriesdemographicsWeb TrackingTraffic BuildingImage OptimizationSearch AnalyticsTraffic GenerationWeb Consultancyperfmance metricsperfmanceConteHVAC Engineer HVAC Engineer with 3+ years of experience in design of large HVAC systems with site specific implementation experience. Required B.Tech/ BE in Mechanical Engineering Sufficient k...
hvacair conditioninghvac systemsiteinspectionsite specificcommunication skillsmechanical engineeringdesignautocadmechanicalengineeringcommunicationimplementationLive ArtContact ImprovisationPerfmance APosition: PPC (ADWORDS) EXPERT Responsibilities: Campaign planning, creation, budget management, performance review, optimization and analysis Must have experience working in E- commerce portals...
lead generationdigital marketingbudget managementcampaign planningmarketing campaignsoptimization strategiesseoppcresumerunningplanninganalysismarketingcampaignsmanagementperfmance reviewtalsperfRoles & Responsibilities Driving the business with the clients and other stakeholders through telephonic calls, mailers, in-person, etc. To maintain and update a status monitoring mechanism on a re...
salesmisaccountstatbankinginhouse salesdigital marketingbusiness developmentcommunication skillsapplication developmentenglishmailersbusinessdevisingmarketingmechanismmonitnetwkingingperfmancepresRoles & Responsibilities Driving the business with the clients and other stakeholders through telephonic calls, mailers, in-person, etc. To maintain and update a status monitoring mechanism on a re...
salesmisaccountstatbankinginhouse salesdigital marketingbusiness developmentcommunication skillsapplication developmentenglishmailersbusinessdevisingmarketingmechanismmonitnetwkingingperfmancepresSenior MS SQL Developer Job Code: mssql_cbe Location : Coimbatore Location: Coimbatore | Job Title: Senior MS SQL Developer Minimum 5- 10 years of experience with good communication skills. Must h...
sql servernetanesthesiabackupbasisms sqlsqlssisssrscommunicationSQL Server Integration ServicesWindows Communication FoundationLanguage Integrated QueryperfmanceTransactSQLSQL Server Repting ServicesHustler, with a strong can do mentality, who is joining us to build on a vision, not to do a job Engineering Excellence: Strong foundation in building fault- tolerant and resilient systems, asynchrono...
javascriptcssjqueryhtmlmysqlfront endserver sideawsgitlinuxsparkhadooppythondevopsjenkinsmongodbjoininganalysisperfmance analysishisti. Maintain availability of machines for production ii. Prepare production schedule based on the priority of the order to be serviced iii. Brief the supervisors and QC team on the production require...
quality controlproduction planningqualityproduction managementmanagementmaintenancecontinuous improvement facilitationmechanical maintenanceperfmanceWe are looking for a PHP Developer responsible for managing back- end services and the interchange of data between the server and the users. Your primary focus will be the development of all server- s...
mysqlphpjqueryjavascripthtmlbasicdatabasemaintenanceintegrationresponsivenessCodeIgniterLaravelSymfonyYiiCakePHPPhpMyAdminPHPUnitperfmanceZend FramewSymfony FramewDevelop and implement innovative instructional methods. Develop professional logistics to improvise student performance. Guide, lead and mentor students in research projects. Evaluate, monitor a...
teachingresearchlogisticsperfmanceresearch projectsstudent activitiesExperience : 5 to 6 years This position is responsible for the day - to - day administration of LMS as well as tools and software integrated with the LMS. The Learning Management System Administrator...
user groupsblended learningprogress trackingmanagement systemlearning managementsystem administrationlmstrainingsoftwarearchivesmanagementstructuresmaintenanceadministrationaccountsperfmanceCustomer EvenResponsibilities: Deal directly with business owners/managers/ client contacts via phone and e-mail, chat. Respond promptly to customer inquiries. Handle and resolve customer complaints within a 1 ...
social mediaenglish languagecontent managementcustomer complaintsemailmedicalenglishtwitterrecbusinessmanagementInteract with All Levels Of ManagementHanhandle confidential infmationperfmanceANDROID DEVELOPER Location :New Delhi Exp : 3YR PLUS Salary :3 to 6 Lakh P.A Excellent knowledge of the Android SDK Knowledge of XML and JSON a requirement Knowledge of SqlLite and a working experie...
sqliteunit testingdatabasesdevelopmentresolutionsql pl sqlsubmissionganisingperfmanceDesignation/ Role Php Developer B Tech, Bca/ Mca, 1 - 5 Yrs Developing E Commerce Websites Using Design Integration In Template & Customization Of Expert In Developing E Commerce Websites Using M...
mysqlphpjqueryjavascripthtmlapidesignmagentotemplatefeaturesintegrationcustomizationCodeIgniterLaravelSymfonyYiiCakePHPPhpMyAdminperfmanceZend FramewUnderstanding requirements and perform the following: Test case design , Test execution , Logging defect in the tool RTC/ QC , Test reporting Hands on working knowledge of Siebel/ Comptel/ MQ/ MB EAI/...
test case designenvironmental impact assessmenttest caseslife cycletest executiontest automationtest environmentssystem requirementscommunication skillstest reptingperfmance metricswritten communicatioCandidate from BI / Analytics Technology Domain will add an advantage & preferably form BFSI / Retail Industry. Provide presales support for sales activities including needs analysis, data review, pro...
salesmarketingbusiness developmenttargetdeliveryneeds analysisselection processprofessional servicesbfsiemailretailtrainingpresalesanalysisanalyticsevaluationADDIEILTAidsPerfmance ConsultingThe candidate will be involved in the following activities: System Level Modeling for Architecture exploration, Performance exploration, SoC performance analysis, tradeoffs...
modeling toolsdata structuresmodel developmentcommercial modelsinternational conferencestlmsocstlbusocpeslmmuoopscachedesigncarbonsystemcanalysisperfmance analysisCome create the technology that helps the world act together Nokia is committed to innovation and technology leadership across mobile, fixed and cloud networks. You...
use casesnetwork planninganalytical skillsservice providersnetwork performancetechnology leadershipoptimization strategiesossrannponicecloudradiocolormobileofferstrialssoftwareplanningASM/ TSM- Speciality Products/ Trauma Activities Meeting business objectives and sales targets for the territory. Accountable for sales, new customer acquisition and market ...
market developmentcommunication skillscustomer acquisitionpansalessurgerytrainingbusinessinstrumentsdistributioncommunicationDisposablesSurgical Instrumentsservice suppreptingperfmanceCapital EquipmenHr generalist Payrole Leave Management Policy, Recruitment Compensation & Benefits etc Job ID : PRITJ00014 Job Title : HR Generalist Experience : (3- 6 yrs) Skills Required ...
recruitmenthuman resourcesinductionemployee engagementrecruitinghr solutionsbrand buildingleave managementemployee relationstalent developmentverbal communicationcompensationbenefitsperfmance managementExperience : Fresher (2018 & 2019 passed out) The Software Engineer Intern will develop software and implement processes to meet various business goals . He or she will be...
build toolsself learningproblem solvingmission criticalsoftware researchsoftware engineerssoftware developmentagiledesignsoftwareresearchbusinessanalystsengineersoperationscommunicationperfmanceOverview Join our Mobile development team working on iOS applications. This is a hands-on developer position. The successful candidate has a strong tech...
javasqljavascriptsql serverjquerydebugging codetechnical abilitymobile developmentcommunication skillsiosdesignmobilebackendwritingfeaturesdebuggingcommunicationperfmanceOverview Join our Mobile development team working on smartphones, tablets, and wearable devices. This is a hands-on developer position. The successful c...
javasqljavascriptsql serverjquerytechnical abilitymobile developmentcommunication skillsdesignmobilebackendwritingtabletsfeaturesdebuggingsmartphonescommunicationperfmanceDesign and develop applications , implement new features , fix bugs , and improve performance of our applications. Work closely with development and QA teams to design and ...
front endcssrubysasshamldesignshippingfeaturesjavascriptWeb StandardsW3CnodejsexpressjsperfmanceBackEnd Web DevelopmentCrossbrowser CompatibilityFrontend DesignFrontend CodingResponsibilities Design and build new applications from the ground up, implement new features, fix bugs, and improve performance of our applications. Work closely with ...
javasqljavascriptsql serverjquerylinuxdesignmobilebackenddesktopeclipsefeaturesData StructuresEmbedded Cmobile platfperfmanceRealTime Operating SystemsResponsibilities Design and develop applications, implement new features, fix bugs, and improve performance of our applications. Work closely with development and QA team...
front endcssrubysasshamldesignshippingfeaturesjavascriptWeb StandardsW3CnodejsexpressjsperfmanceBackEnd Web DevelopmentCrossbrowser CompatibilityFrontend DesignFrontend CodingOverview Join our Web development team working on consumer facing front- ends. This is a hands- on developer position. The successful candidate has a strong technical abil...
web developmenttechnical abilitycssrubysasshamldesignwritingshippingfeaturesdebuggingjavascriptcommunicationXHTMLnodejsexpressjsperfmanceFrontend DevelopmentBachelors Degree in Sales, Marketing or Business preferred with a minimum of 1 years related experience with progressive managerial responsiblities. Good Communication and D...
market researchmarketing strategystrategic marketingassociation meetingssalesresearchbusinessstrategymarketingnegotiationdocumentationcommunicationPrimary ResearchAdvsales fecastingecastingperfmanceHighly performance oriented / target oriented Excellent team leader & players , with the ability to work in a collaborative and consultative manner Assumes responsibility ...
marketingsalescustomer relationsbusiness developmentadvertisingnetcommunicationaccountabilityWindows Communication FoundationLanguage Integrated QueryWindows Presentation FoundationSildonperfmanceWinFPerformance Test Engineer L2 3 to 5 Yrs Apply to this job, Performance Test Engineer L2 3 to 5 Yrs Apply to this job,...
load runnerhttphtmlscriptingMaster ClassesSymphonySolo RecitalsArt SongStringRecitalsLessonsLyricalperfmance testingperfmanceSolo PerfmancePerformance Test Lead Apply to this job, Performance Test Lead Apply to this job,...
load runnerhtmlhttploadrunnerMaster ClassesSymphonySolo RecitalsArt SongStringRecitalsLessonsLyricalperfmance testingperfmanceSolo PerfmanceJob Description Developing and maintaining web application using Core Java, spring, JDBC, ORM, MVC Architecture. Performing Performance Tuning, Security Fixes, SDLC Maintenance using SVN, Bugzilla...
music makingweb applicationsvnjavajdbcsdlcspringjmetersecuritybusinessbugzillamaintenancepreparationServletsSwingsJava Database Connectivitye javaperfmance tuningperfmanceFaculty for Physics, Chemistry, Maths & Biology Mumbai / Delhi / Pune / Nagpur / Kota Desired Profile The candidate must be Graduate / Post Graduate with subject specialization and adequate experi...
mathsphysicsbiologychemistrymanagementGeometryAbstract AlgebraAlgebraAlgebraic GeometryCalculusTrigonometryPure MathematicsMathematical PhysicsAstrophysicsganicperfmanceNumber TheExperimental PhysWe are looking for an Android Developer who possesses a passion for pushing mobile technologies to the limits and will work with our team of talented engineers to design and build the next generation ...
design specificationsxmlsalesdesignmobiledemandtestingandroidmockupsarchivesdiagnoseusabilityengineerscomponentsleadershipdeploymentinterfacesimplementationspecificationsperfmanceAndroid App Developer Android Developer jobs in Thane, Mumbai | Android app development company in Thane Android App Developer We are looking for an Android Developer who possesses a passion for pushi...
design specificationsxmlsalesemaildesignmobiledemandtestingandroidmockupsarchivesdiagnoseusabilityengineerscomponentsleadershipdeploymentinterfacestranspromoperfmance© 2019 Hireejobs All Rights Reserved