Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
If you are PASSIONATE, ADAPTABLE, and INNOVATIVE, Xilinx is the right place for you! At Xilinx we care deeply about creating meaningful development experiences while building a strong sense of belongi...
static timing analysissoftware quality assurance eda toolsglobal teams data structuresproblem solving timing analysismachine leaWeb Designers/ GUI Designers/ Logo Designers Photoshop expert Dream weaver expert CorelDraw working knowledge JavaScript expert Flash working knowledge XHTML expert HTML expert CSS - exper,...
css gui html logo flash xhtml photoshop javascript XHTML SASS HTML5 LESS Bootstrap WebStandards GruntJS jQuery ServerSide Motif ldraw FrontendDevelopmentDescription Job Title: IMS Senior D eveloper Department: IMS Were looking for S enior Software P rofessional to join our IMS department, which supports management and production tools. Support i...
java jquery sqlserver sql environment certifiedtipstrainer webservices visualeffects remotecontrol versioncontrol timemanagement agilemethodology ticketingsystems oftwaresupp perf mancetuning useDescription Job Description Job Title: IMS Developer Department: IMS We a re looking for smart, driven software professional to join our IMS department, which supports management and productio...
remotecontrol versioncontrol timemanagement operatingsystems agilemethodology ticketingsystems datavisualization userdocumentation visualizationsoftware erp cms ims java jira saas sdlc oftwaresupp liApplication support -Support on tools like BRM, CRM, Mediation, Revenue Assu rance etc. - Daily Report generation monitoring and triggering in case of failures. -System health check and pro-active res...
mis documentation finance insurance healthcheck professionalliability unix plsql checks housing running ep tgeneration
Post Graduate Degree in Social Science or equivalent. Good experience as Team Leader or senior position 15 year experience in Community Development activities Experience in design and implementatio...
salescustomer relations slaquality coachingwater supply social sciencecommunity developmentJob Profile For Client Projects Understanding client brief and translating the same to prepare effective online, digital as well as offline communique Should devise and implement suitable communic...
contentmanagementwritingwebsiteproductionadvertisingaudioeditingstrongcommunicationskillscontentwritingcommunicationskillsbasicdesignchecksenglishbannersritingfthewebatecommunicationsWeb Designers/ GUI Designers/ Logo Designers Photoshop expert Dream weaver expert CorelDraw working knowledge JavaScript expert Flash working knowledge XHTML expert HTML expert CSS - exper,...
cssguihtmllogoflashxhtmlphotoshopjavascriptXHTMLSASSHTML5LESSBootstrapWebStandardsGruntJSjQueryServerSideMotifldrawFrontendDevelopmentPosition Sr Engineer-Agri Tech Place of Posting MRV, Chennai Roles and Responsibility Proof of concept development in data analytcs for automotive domain Experience in Predictive...
concept developmentprecision agriculture pythonanalytics automotiveagriculture intelligenceDesign StrategyVOIP Software Architect position Job Code : voipa Location : Pune, Maharashtra, India Experience : 2- 6 years Responsibilities : The successful candidate will provide leadership in the p...
javadeliverysitesqlserverdetaildesignproductdevelopmentembeddeddevelopmentsoftwarearchitecturevoipmgcplinuxdesignsoftwareembeddedplanningleadershiparchitecturearchitectingramewThe successful candidate will provide leadership in the planning, design and construciton of the clients VoIP products. This includes envisioning and documenting the software architecture that will be...
javadeliverysitesqlserverdetaildesignproductdevelopmentembeddeddevelopmentsoftwarearchitecturevoipmgcplinuxh323designsoftwareembeddedplanningleadershiparchitectureramew"
"
"
"
Our client is a pioneer and leader in technology enabled cab services in India , offering comprehensive end to end travel solutions for individual as well as corporate requirements that cover both int...
machine learningpython data analysissql analyticsdata mining data modelsdeep learningProof of concept development in data analytcs for automotive domain Experience in Predictive and prescriptive analytics Experience in tools and hands on developemnt experience with Python Mathemati...
concept developmentpython analyticsStrategic DesignResponsibilities & Key Deliverables Partner with stakeholders, users to elicit and Document business requirements, Prepare BRDs, RFPs & translates nontechnical requirements into technical l bu...
ms officeflow charts it consultingquality testing project planningbusiness analysis business requirementsrequirements gatheringAccenture Technology powers our clients businesses with innovative technologies established and emerging changing the way their people and customers experience work, life and entertainment. Join Accen...
lanwanstpbgppixasaccnaitilccnpospfhsrpvtpmanPartner with stakeholders, users to elicit and Document business requirements, Prepare BRDs, RFPs & translates nontechnical requirements into technical l business requirements. Communicate with inter...
ound knowledge of BI Power BI Excel MacroQuality Testing System testingProject planning Tools
Skill and Experience Level (12 + Yrs) :- Good hands on experience on Ecommerce Tools (SFCC (Demandware) / Hybris). Has creative problem-solving skills related to teams , project deliverables , and cro...
projectmanagementjavadeliveryriskmanagementproblemsolvingtingcustomerrelationsstatementsofwksowlifecycleteamleadingagiledevelopmentmanagementskillsoperationalexcellencedevelopmentma Sipl Hiring this Week
company Dhruve Iconic Pvt. Ltd
client Megha
location Patna
manpower Telecaller 4 Person
Salary Fresher 6k
TelecallingBPOTelemarketingTelesales
Partner with stakeholders, users to elicit and Document business requirements, Prepare BRDs, RFPs & translates nontechnical requirements into technical l business requirements. Communicate with inter...
ound knowledge of BI Power BI Excel MacroQuality Testing System testingProject planning ToolsResponsible for providing activity support to UK based Service Managers and to administer regional WIP opportunities in order to deliver the best possible service exper ience for customers. This rolei...
wipitilbasicsalesmanagementstandicatorssetexcelperformanceownershipanalysisdetHi, We have immediate requirement Physical Design Engineer with 5 - 12Years experience Please send updated resume along with the details shiva@cambio.co.in Full Name C.T.C E.C.T.C Reason For Job...
edagdsdrclvsdesigndivtapetimingchecksresumeclosureplanningJob Details : 1-2 years experience in Search Engine Optimization (SEO) - Experience working with popular keyword tools (Google, WordTracker, Keyword Discovery, etc) -Exper- Black hat,white hat Salary ...
internetmarketingnowledgeofGoogledTrackerKeywdDiscoveryWe are a global operation and for great customer experience we need continual effort to make that delivery reliable. In order to drive reliability, we need you -- someone who already is, or is interes...
automation telecom equipment design autocadazure applicationdashboards customer experRole :Application Developer Role Description :Design, build and configure applications to meet business process and application requirements. Must Have Skills :Meter Data Management (MDM) Good To Have...
data managementoutsourcing marketingmanagement designqueries business developmentjavaRole :Application Developer Role Description :Design, build and configure applications to meet business process and application requirements. Must Have Skills :Dell Boomi Good To Have Skills :EDI (Ele...
automationoutsourcing operationscloudPosition : BUSINESS DEVELOPMENT EXECUTIVE Qualification : Graduate / MBA Experience : 1-2 Years ( profiles Laptop and Bike ) Salary : 25% - 30 % Hike on current Salary Location : Chandigarh Job...
advertisingresearchb2bppcwhograduateseonetworkingevelopmentbusinesscallingcoldThis role is part of the new Office IT team within Vodafone Shared Services. The IT Delivery & Transformation Manager acts as an exper ienced project manager, managing end to end complex projects thro...
systemsdeliveryfocusmanagementtransitioncommercialbudgetoperationsstrategyerpautomationmarketingsupportsalesrojectdevelopmentbusinessGreetings From Quest Valley !! Hiring For International Voice Process
Job Details : 1-2 years experience in Search Engine Optimization (SEO) - Experience working with popular keyword tools (Google, WordTracker, Keyword Discovery, etc) -Exper- Black hat,white hat Salary ...
Position : BUSINESS DEVELOPMENT EXECUTIVE Qualification : Graduate / MBA Experience : 1-2 Years ( profiles Laptop and Bike ) Salary : 25% - 30 % Hike on current Salary Location : Chandigarh Job...
advertisingresearchb2bppcwhograduateseonetworkingdevelopmentbusinesscallingcold© 2019 Hireejobs All Rights Reserved