Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Sales Executive Jobs in Chennai - Vacancy in Sales/Marketing Sales Executive 1 - 3 Years Chennai, TAMIL NADU Job Description Responsible for distribution expansion in the assigned area Locate ef...
training marketing negotiation sales basic communication distribution stores amil salary medical negotiationskills salesmarketing moderntrade executivetrainingShould have strong exposure in Litigation Drafting agreements Statutory compliance Preference for local candidates , Desired Profile Age-Max 35 years Preferred from Telecom/ISP company Local lang...
drafting compliance litigation agreements draftingagreements amil statut statut ycomplianceHiring Tamil and Gujarati Translator for a Leading IT Company in Bangalore Job Profile *Proof reading *Translation from English to Gujarati *Grammar and Spelling verification etc. ,...
english grammar translation proofreading amil proof salary gujarati spellingPrior experience in Telesales and Telemarketing of Software Product will be an added advantage. Candidate should have a positive attitude & should be Goal oriented Candidate should possess Good oral...
sales hindi english software telesales coldcalling telemarketing communication leadgeneration communicationskills amil business pressure writtencommunicationSales Executive Jobs in Chennai - Vacancy in Sales/Marketing Sales Executive 1 - 3 Years Chennai, TAMIL NADU Job Description Responsible for distribution expansion in the assigned area Locate ef...
training marketing negotiation sales basic communication distribution stores amil salary medical negotiationskills salesmarketing moderntrade executivetrainingJob Description Lead Generation and cold calling . Qualify the prospect and fix up a meeting . About the role Prior experience in Telesales and Telemarketing of Software Product will be an added...
sales hindi english software telesales coldcalling telemarketing communication leadgeneration communicationskills amil pressure prospect writtencommunicationFunctional Area : IT - Software Functional Role : IT Software - Mobile 0- 2 Yrs Job Location : Dahisar East, Mumbai iPhone Developer 6 months to 2 years of experience on iPhone app development Prefe...
wifi ipad mobile xcode https sqlite software json xml amil survey opensource iphoneJob Description Lead Generation and cold calling . Qualify the prospect and fix up a meeting . About the role Prior experience in Telesales and Telemarketing of Software Product will be an added...
sales hindi english software telesales coldcalling telemarketing communication leadgeneration communicationskills amil pressure prospect writtencommunicationFunctional Area : IT - Software Functional Role : IT Software - Mobile 0- 2 Yrs Job Location : Dahisar East, Mumbai iPhone Developer 6 months to 2 years of experience on iPhone app development Prefe...
wifi ipad mobile xcode https sqlite software json xml amil survey opensource iphoneDear Aspirants, With a warm greetings from Hucon Solutions, I brought you the most demanded openings into one of the leading MNC. Please go through the following details; Any Graduate Must have go...
service malayalam gujarati customer voice amil bengali kannada semivoice hinditeaching customersupport internationalvoiceprocess semivoiceprocess voiceprocessSales Executive Jobs in Chennai - Vacancy in Sales/Marketing Sales Executive 1 - 3 Years Chennai, TAMIL NADU Job Description Responsible for distribution expansion in the assigned area Locate ef...
training marketing negotiation sales basic communication distribution stores amil salary medical negotiationskills salesmarketing moderntrade executivetrainingFunctional Area : IT - Software Functional Role : IT Software - Mobile 0- 2 Yrs Job Location : Dahisar East, Mumbai iPhone Developer 6 months to 2 years of experience on iPhone app development Prefe...
wifi ipad mobile xcode https sqlite software json xml amil survey opensource iphoneNo charges !! Day Shift only. ************** Walk in interview *************
Dear candidate, we are hiring for leading fashion company. position- okhala ctc- 3 lk Job Description - Cashier To emphasis on add on sales & increase in average bill value Customer Service To ...
cash vouchers pos bar returns sales security credit ettycashmanagement cashmanagement customerdata storeoperations giftvouchers comparisonshopping inventoryaudit customerreturns customerservice codeofconduct systemintegrators pettycashShould have strong exposure in Litigation Drafting agreements Statutory compliance Preference for local candidates , Desired Profile Age-Max 35 years Preferred from Telecom/ISP company Local lang...
draftingcompliancelitigationagreementsdraftingagreementsamilstatutstatutycomplianceClient Processing - IC1 Performs routine and non- routine client service and transactional support functions. Interacts with other organizational units/ teams to ensure timely delivery of service, or...
researcheducationservicingbrokerageoperationsclientservicingamilbusinessadaptationexternalclientsequalemploymentopptunityclientserviceClient Reporting, Performance - IC1 Provides assistance in monitoring and collecting data on the performance of client portfolios. Fields questions about reporting systems and reports that are used a...
risktradingresearcheducationservicingbrokeragemanagementmaintenanceriskmanagementdatacollectionamilreptingtfoliomonitingperfmanceClient Reporting , Performance - IC1 Provides assistance in monitoring and collecting data on the performance of client portfolios. Fields questions about reporting systems and reports that are used ...
risktradingresearcheducationservicingbrokeragemanagementmaintenanceriskmanagementdatacollectionamilreptingtfoliomonitingperfmanceJob Description Lead Generation and cold calling . Qualify the prospect and fix up a meeting . About the role Prior experience in Telesales and Telemarketing of Software Product will be an added...
saleshindienglishsoftwaretelesalescoldcallingtelemarketingcommunicationleadgenerationcommunicationskillsamilpressureprospectwrittencommunicationJob Description
Your Profile is Shortlisted forNon Voice Process and Tamil Voice ProcessReach Jayaraghavi HR @ 9551049848for Further rounds of Interview and Venue Detail Welcome Letter Hiring for Non Voice Job Pr...
amil voice processbpo non voicevoice supportdomestic voice processinternational voice processvoice processGreetings from Q Way Technologies!! We have an urgent opening for Financial Transaction Executive (Charge entry and payment posting) in the US healthcare domain. Position Title: Financial Transactio...
billingamilresumeentryvenuechargemedicalpingpostinghealthcareopeningspaymentGreetings to all from Pharma Placements Inc . We have been hired by One of the Top 30 Pharma Companies to hire a Regional Manager to be located at Chennai. The details of the position are a...
salesmarketingbusinessdevelopmenttargetretailturnoverKannadaSanskritamilthopharmatherapyterritMalayalamTeluguHinduismMalayBengaliBahasaMalaysiaGujaratiTo ensure Achievement of budgeted Gross Adds, ARPU & Revenue targets as per AOP by increasing the productivity of the sales team Role Description: 1. Designing and expanding training and development...
educationsalesenglishretailaopmisamilhousedivmaterialssalaryFor More details WhatsApp to HR at 06238539995 Urgent Hiring for Home Based Data Entry/ Form Fiiling/ Ad posting/ Online Typing /TeleCalling /Copy- Paste work in Excel For details Send your NAME on ...
hinditelemarketingtelecallingenglishtelesalesamilteluguvoiceprocessinboundcustomercaredomesticvoiceFor More details WhatsApp to HR at 06238539995 Urgent Hiring for Home Based Data Entry/ Form Fiiling/ Ad posting/ Online Typing /TeleCalling /Copy- Paste work in Excel For details Send your NAME on ...
hinditelemarketingtelecallingenglishtelesalesamilteluguvoiceprocessinboundcustomercaredomesticvoiceFor More details WhatsApp to HR at 06238539995 Urgent Hiring for Home Based Data Entry/ Form Fiiling/ Ad posting/ Online Typing /TeleCalling /Copy- Paste work in Excel For details Send your NAME on ...
hinditelemarketingtelecallingenglishtelesalesamilteluguvoiceprocessinboundcustomercaredomesticvoiceHi.! Position : Customer Service Associate No of Positions : 20 Positions INTERVIEWS WILL BE CONDUCTED ON 26thJune 2019 at 10:00 AM. Totally 3 rounds and same day Offer. Joining in 1 week required....
hindikannadaamilcustomerservicecallcentervoiceprocessNeed TGT Tamil, Kannada, Sanskrit, English, Science, Math, teacher in High School. Education: Minimum Graduationis required. Candidate with B.ed will get preference & higher salary. Skill: Excellent...
tgtscienceenglishsanskritkannadaamilmathschoolteacherProvides entry - level support for the completion of accounting activities for a legal entity , line of business , region or accounting process. May support research and analyses related to financial ...
financeresearcheducationsupervisionqualitycontrolfinancialaccountingamilcontrolbusinessanalysiscompletionperfmanceregulationsissueresearchaccountingissuesProject Lead - Application Support>> Maintains and supports applications and their operating environments. Fields calls and addresses technical problems. Records , documents , and resolves or escalate...
sciencerecsoftwarehelpdeskmanagementsecuritiesdocumentationcomputersciencefinancialservicestechnologymanagementamiltestscontingencyapplicationsuppinfmationtechnologyNeed English, Tamil, Math, Physics, Computer Application, Chemistry Professor or Asst Professor. Education: Minimum Post Graduation Degree is required. NET/ SLET or PHD is required Skill: Excellent ...
chemistryenglishphysicsamilcomputerapplicationprofessormathasstprofessorBusiness Analyst- >> Analyzes and defines the business requirements and functional or operational architecture for moderately complex projects. Formulates and defines system scope and objectives by th...
designtestingsoftwaremanagementoperationssecuritiesarchitecturedocumentationtechnicaldesignbusinessprocessfunctionaldesignfinancialservicesamilbusinessanalystsNeed TGT Tamil, Kannada, Sanskrit, English, Science, Math, teacher in High School. Education: Minimum Graduationis required. Candidate with B.ed will get preference & higher salary. Skill: Excellent...
tgtscienceenglishsanskritkannadaamilmathschoolteacher
Maintaining high standards of hygiene Preparing the ingredients for a more senior chef Measuring dish ingredients and portion sizes accurately Dealing with deliveries and stock rotation Reporting ...
commibakerycookingstockcdpkitchenndiancurrycontinentalfoodprocessingdcdpfoodpreparationfoodproductionindianrotationfoodqualitycontroltandoorchinesedeliveriesfoodtechnologycommisfoodpackingSenior Appl Support Analyst- >> Maintains and supports applications and their operating environments. Fields calls and addresses technical problems. Records, documents, and resolves or escalates softw...
sciencerecsoftwarehelpdeskservicingmanagementsecuritiesdocumentationcomputersciencefinancialservicestechnologymanagementamiltestscontingencyassetservicingAssistant Professor- Tamil Develop and implement innovative instructional methods. Develop professional logistics to improvise student performance. Guide, lead and mentor students in research pro...
teachingresearchlogisticsamilcommitteesassistantsperfmanceresearchprojectsstudentactivitiesClient Reporting, Performance - IC1 Provides assistance in monitoring and collecting data on the performance of client portfolios. Fields questions about reporting systems and reports that are used a...
risktradingresearcheducationservicingbrokeragemanagementmaintenanceriskmanagementdatacollectionamilreptingtfoliomonitingperfmanceInformation Security Analyst- >> Supports the effectiveness of security- related operations. Provides programming support and assists in project planning for an operational area in information securit...
sciencesoftwaresecurityoperationssecuritiescomputerscienceprojectplanningfinancialservicesamilreviewsbusinessplanningcomponentsbusinesssystemsinfmationsecurityProvides entry- level support for the completion of accounting activities for a legal entity, line of business, region or accounting process. May support research and analyses related to financial per...
financeresearcheducationsupervisionqualitycontrolfinancialaccountingamilcontrolbusinessanalysiscompletionperfmanceregulationsissueresearchaccountingissuesClient Processing - S6 Serves as a lead for the day- to- day operations of a small- to medium- sized client processing support team, providing work direction and technical assistance on complex matte...
riskreceducationmanagementoperationscompliancesecuritiesfinancialservicescompliancemanagementamilbusinessregulationsclientsuppclientaccountstechnicalassistanceClient Processing - S6 Serves as a lead for the day- to- day operations of a small- to medium- sized client processing support team, providing work direction and technical assistance on complex matte...
riskreceducationmanagementoperationscompliancesecuritiesfinancialservicescompliancemanagementamilbusinessregulationsclientsuppclientaccountstechnicalassistanceProvides support for the completion of accounting activities for a legal entity , line of business , country , region or accounting process. Supports research and analyses related to financial perform...
financeresearcheducationqualitycontrolamilcontrolbusinessanalysisreptingregulatcompletionperfmanceregulationsimplementationissueresearchhe processes the reservation requests that reach the hotel by any mode. He should possess great salesmanship skills by suggesting higher room categories, &also selling other hotel services like spas, ...
administrationightauditingfrontofficemanagementofficeassistanceticketbookingreceptionistactivitiesreceptiongeneralofficemanagementcashcollectionfrontdeskreceptiontravelmanagementWe are looking for 2 Recruitment Consultant to join our company. The job involves the following responsibilities: 1. Finding, screening and short-listing the most suitable candidates for our clients...
sourcingcommunicationenglishamilmalayalamofficeNeed Asst Professor for Commerce, Management, Tamil & English. INTERESTED CANDIDATE should CALL/ WHATSAPP on 7003064115 Qualification: Master degree on relevant subject with NET/ SLET / PHDis Compul...
englishmanagementamilcommerceprofessorcommercecollegeHotel Stewards perform a variety of duties and responsibilities every shift. They often must switch back and forth between multiple tasks, which takes a flexible work style. The following list outline...
cateringstewardsbhmtewardswaiterhotelmanagementguestrestaurantUrgent requirement Dear Candidate male / female for Bpo voice and NonVoice process domestic/international Salary :- 10k - 15k Cab Facility Available Qualification:- intermediate, any degree fres...
hindikannadaamilteluguurdumalayalamNeed English, Tamil, Math, Physics, Computer Application, Chemistry Professor or Asst Professor. Education: Minimum Post Graduation Degree is required. NET/ SLET or PHD is required Skill: Excellent ...
chemistryenglishphysicsamilcomputerapplicationprofessormathasstprofessor© 2019 Hireejobs All Rights Reserved