hireejobs
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

FXEM Product Controller Director

5.00 to 7.00 Years   Mumbai City   10 Jul, 2019
Job LocationMumbai City
EducationNot Mentioned
SalaryNot Disclosed
IndustryBanking / Financial Services
Functional AreaGeneral / Operations Management
EmploymentTypeFull-time

Job Description

- manage & overview daily reconciliation of the Risk systems attributed P&L to the Reporting system- drive controls; help the team in identifying and investigation of breaks; escalate issues in a timely manner to management- manage a team up to 5 members; supervise, train or guide team members; inspire and motivate team members; provide effective feedback- understand the businesses supported including the strategy, products and inherent risks.- understand the risk & reporting systems and contribute to enhancing the control environment.- contribute to Finance related projects, process enhancements, UAT testing etc.- Other P&L related tasks and requests as requiredSkills required:- Strong academic background including a Graduation in Commerce, specialization in Financial Accounting- Prior Business Unit/ Product control experience with a knowledge of financial products, preferably in Fixed Income- Strong analytical & problem solving bent of mind- Attention to detail- Ability to work to tight deadlines- Excellent communication skillsQualifications desired:- Graduate in Finance stream, CFA / FRM will be added an advantage- Preferred 5-7 years of industry experience (Investment Banking / Capital Markets related experience an advantage), preferable in the PC domain.- Understanding of FX & Interest rate products like Swaps, Bonds, Futures & Options would be an added advantage,

Keyskills :
ledgertradingbasisixedincomederivativesfixedincomefrontofficewealthmanagementproblemsolvingreportingsystemsfinancialservibalancesheetproductcontrolcapitalmarketsrisksystemsfinancialcontrolinvestmentbanking

FXEM Product Controller Director Related Jobs

© 2019 Hireejobs All Rights Reserved