Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Job Location | Mumbai City |
Education | Not Mentioned |
Salary | Not Disclosed |
Industry | Banking / Financial Services |
Functional Area | General / Operations Management |
EmploymentType | Full-time |
- manage & overview daily reconciliation of the Risk systems attributed P&L to the Reporting system- drive controls; help the team in identifying and investigation of breaks; escalate issues in a timely manner to management- manage a team up to 5 members; supervise, train or guide team members; inspire and motivate team members; provide effective feedback- understand the businesses supported including the strategy, products and inherent risks.- understand the risk & reporting systems and contribute to enhancing the control environment.- contribute to Finance related projects, process enhancements, UAT testing etc.- Other P&L related tasks and requests as requiredSkills required:- Strong academic background including a Graduation in Commerce, specialization in Financial Accounting- Prior Business Unit/ Product control experience with a knowledge of financial products, preferably in Fixed Income- Strong analytical & problem solving bent of mind- Attention to detail- Ability to work to tight deadlines- Excellent communication skillsQualifications desired:- Graduate in Finance stream, CFA / FRM will be added an advantage- Preferred 5-7 years of industry experience (Investment Banking / Capital Markets related experience an advantage), preferable in the PC domain.- Understanding of FX & Interest rate products like Swaps, Bonds, Futures & Options would be an added advantage,
Keyskills :
ledgertradingbasisixedincomederivativesfixedincomefrontofficewealthmanagementproblemsolvingreportingsystemsfinancialservibalancesheetproductcontrolcapitalmarketsrisksystemsfinancialcontrolinvestmentbanking