hireejobs
Register for Job
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

Mainframe Developer

4.00 to 9.00 Years   Chennai   29 Mar, 2019
Capgemini
Job LocationChennai
EducationNot Mentioned
SalaryNot Disclosed
IndustryIT - Software
Functional AreaGeneral / Other Software
EmploymentTypeFull-time

Job Description

Job Responsibilities:Capgemini | Walk-In Interview for Mainframe Developer in Chennai on 5th Jan 2019(Saturday)Greetings!We would be conducting interviews for Mainframe Developer on 5th Jan 2019(Saturday)

  • Technical competency CICS , DB2 , COBOL , JCL, VSAM (All Mandatory skills).
  • Overall MF experience of 4-9 yrs.
  • Minimum Hands on duration for CICS / DB2 (4 + years)
  • Ability to develop technical design from functional specifications
  • Ability to do impact analysis for given functional / technical design
  • Ability to create High level and low level design / estimation
  • Capability for Coding/Unit and Integration /system testing
  • Ability to do code reviews and create test plan
  • Good communication skills & client interaction experience would be a plus.
  • Banking or Insurance domain knowledge would be helpful.
  • DB2 is mandatory
Primary Skills:
  • DB2
Secondary Skill:
  • Cobol & Jcl & CICS
Drive LocationCapgemini Technology Services India Limited,PRESTIGE CYBER TOWERS,NO.117, RAJIV GANDHI SALAI,KARAPAKKAM, ChennaiDrive Date: 5th Jan 2019(Saturday)Timings 9:00 AM to 3:00 PMDocuments to carry:
  • Printout of this email
  • Hardcopy of the resume
  • Passport size photograph, Photo ID & Company ID card
  • Latest salary slip (preferred)
  • Latest Offer letter or Increment / salary revision letter from current employer
  • Pay slips of last 3 months
,

Keyskills :
integrationvsamslipdesignsystemmainframecoboltestingdb2cicseveltechnicallow

APPLY NOW

Mainframe Developer Related Jobs

© 2019 Hireejobs All Rights Reserved