hireejobs
Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs
Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales
Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs
IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

ACN Digital Analytics Operations Analytics 9

2.00 to 6.00 Years   Bangalore   27 Apr, 2019
Job LocationBangalore
EducationNot Mentioned
SalaryNot Disclosed
IndustryIT - Software
Functional AreaInternet MarketingGeneral / Operations Management
EmploymentTypeFull-time

Job Description

Working through the phases of project: - Define data requirements for creating a model and understand the business problem - Clean, aggregate, analyze, interpret data and carry out quality analysis of it. - Set up data for statistical modeling - Development of statistical/econometric models. Working along with the team and consultant/manager Looking for insight and creating a presentation to demonstrate these insights. Supporting development and maintenance of proprietary marketing techniques and other knowledge development projects Qualifications: Master degree in Statistics/Econometrics/ Economics from reputed institute. M.Phil./PhD in statistics/econometrics or related field. Must Have Skills: SAS/R & Machine learning Strong analytical skills with the ability to collect, organize and analyze significant amount of data with attention to detail and accuracy Proficiency with MS excel, PowerPoint MBA/M Tech Industrial Engineering or Management /PG in Engineering or Statistics/ PhD in Operations research / optimization domain #Digital,

Keyskills :
engineeringtechintelligencestatisticssecurityj2eemanagementmarketingtestingmaintenancejavasqlanalyticsrtificialdatamanualdigital

ACN Digital Analytics Operations Analytics 9 Related Jobs

© 2019 Hireejobs All Rights Reserved