Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Job Location | Bangalore |
Education | Not Mentioned |
Salary | Not Disclosed |
Industry | IT - Software |
Functional Area | Internet MarketingGeneral / Operations Management |
EmploymentType | Full-time |
Working through the phases of project: - Define data requirements for creating a model and understand the business problem - Clean, aggregate, analyze, interpret data and carry out quality analysis of it. - Set up data for statistical modeling - Development of statistical/econometric models. Working along with the team and consultant/manager Looking for insight and creating a presentation to demonstrate these insights. Supporting development and maintenance of proprietary marketing techniques and other knowledge development projects Qualifications: Master degree in Statistics/Econometrics/ Economics from reputed institute. M.Phil./PhD in statistics/econometrics or related field. Must Have Skills: SAS/R & Machine learning Strong analytical skills with the ability to collect, organize and analyze significant amount of data with attention to detail and accuracy Proficiency with MS excel, PowerPoint MBA/M Tech Industrial Engineering or Management /PG in Engineering or Statistics/ PhD in Operations research / optimization domain #Digital,
Keyskills :
engineeringtechintelligencestatisticssecurityj2eemanagementmarketingtestingmaintenancejavasqlanalyticsrtificialdatamanualdigital